PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_016484669.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family B3
Protein Properties Length: 462aa    MW: 52465.8 Da    PI: 8.8129
Description B3 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_016484669.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B339.41.1e-1227116198
                     EEEE-..-HHHHTT-EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EEE CS
              B3   1 ffkvltpsdvlksgrlvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvvk 95 
                     ffk+    + ++ +rl++p +fa+++ ++  ++  + le +sg++Wev++    ++g+++l+ GW++F +   +  g f++F ++ rs f  +v+
  XP_016484669.1  27 FFKII--LSQHECRRLRIPEDFASRYCKNMLNP--VYLEVPSGEVWEVEV--VHSRGQIYLGIGWQDFNDFYSISCGHFLMFGYNARSHF--NVT 113
                     66666..66677789***********5454444..***************..999999**************************999999..999 PP

                     EE- CS
              B3  96 vfr 98 
                     +f+
  XP_016484669.1 114 IFD 116
                     987 PP

2B352.96.5e-17239320489
                     E-..-HHHHTT-EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSE CS
              B3   4 vltpsdvlksgrlvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrse 89 
                      + ps+v + ++l++p kfa+++ +++++  +l+l+ + +  W+vk++ r k     +  GWk Fv +n+Lk gD++v++++++++
  XP_016484669.1 239 FMHPSYVRRPHCLSIPLKFARKYFMQNRG--KLVLRVPGSGFWTVKCTLRTKNA--RINCGWKAFVLDNKLKLGDVCVLEVIKDTK 320
                     57899******************777555..7***************6666554..59**********************988643 PP

3B350.24.5e-16368457498
                     E-..-HHHHTT-EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EEEEE- CS
              B3   4 vltpsdvlksgrlvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvvkvfr 98 
                      + ps+v+  + l++++  a+++     +   ++l+ ++ rsW +++++  k     l +GWk+Fv++n+Lk+gD++vF+ ++r++f ++v +f 
  XP_016484669.1 368 PMQPSYVSGPS-LTISRVIASKFFPT--RYSGVVLQVPNKRSWALNCTVGTKN--GKLNSGWKKFVQDNNLKVGDVCVFEQVSRTRFLFNVYIFP 457
                     56677777776.99999999888533..33359**************664444..45***********************888899988888875 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.40.330.102.1E-1819118IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019361.35E-1721118IPR015300DNA-binding pseudobarrel domain
CDDcd100178.72E-1225116No hitNo description
PROSITE profilePS5086311.09625118IPR003340B3 DNA binding domain
SMARTSM010191.9E-727118IPR003340B3 DNA binding domain
PfamPF023621.3E-927116IPR003340B3 DNA binding domain
Gene3DG3DSA:2.40.330.101.6E-23228327IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019363.73E-21229322IPR015300DNA-binding pseudobarrel domain
CDDcd100178.67E-18234330No hitNo description
SMARTSM010191.4E-10235332IPR003340B3 DNA binding domain
PROSITE profilePS5086311.843236330IPR003340B3 DNA binding domain
PfamPF023628.4E-15239321IPR003340B3 DNA binding domain
Gene3DG3DSA:2.40.330.101.0E-22357456IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019366.41E-21358456IPR015300DNA-binding pseudobarrel domain
CDDcd100173.74E-19363457No hitNo description
PROSITE profilePS5086312.167364459IPR003340B3 DNA binding domain
SMARTSM010192.8E-12365459IPR003340B3 DNA binding domain
PfamPF023623.5E-14369457IPR003340B3 DNA binding domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 462 aa     Download sequence    Send to blast
MAAKRQTPSG EGSSIWNSST NITQPKFFKI ILSQHECRRL RIPEDFASRY CKNMLNPVYL  60
EVPSGEVWEV EVVHSRGQIY LGIGWQDFND FYSISCGHFL MFGYNARSHF NVTIFDLSAS  120
EVEYPTKEIE SDDSIDISDV VEHSVENLSH GPLGQERKRK RQEGEAVDDI PVIVQTKVIE  180
EEKSQGNVVS LERSEGCREQ EQQSNIATSK SDAERDKERA ENYQRAKAFK SKNPFIISFM  240
HPSYVRRPHC LSIPLKFARK YFMQNRGKLV LRVPGSGFWT VKCTLRTKNA RINCGWKAFV  300
LDNKLKLGDV CVLEVIKDTK LLLIDVTIFP GVSDSTNESI NPEPSVPCSP AYQRAKAFTS  360
ENPFFIYPMQ PSYVSGPSLT ISRVIASKFF PTRYSGVVLQ VPNKRSWALN CTVGTKNGKL  420
NSGWKKFVQD NNLKVGDVCV FEQVSRTRFL FNVYIFPAVE GV
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4i1k_A6e-1420332918140B3 domain-containing transcription factor VRN
4i1k_B6e-1420332918140B3 domain-containing transcription factor VRN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC2154042e-38AC215404.2 Solanum lycopersicum cultivar Heinz 1706 chromosome 2 clone C02HBa0163K16, complete sequence.
GenBankHG9755142e-38HG975514.1 Solanum lycopersicum chromosome ch02, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016484669.10.0PREDICTED: B3 domain-containing protein LOC_Os12g40080-like
TrEMBLM0ZSN01e-171M0ZSN0_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000071991e-170(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA7591893
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G18990.11e-33B3 family protein